MeSH Browser

MeSH Supplementary: conophysin-R, Conus radiatus
Unique ID: C470870
RDF Unique Identifier: http://id.nlm.nih.gov/mesh/C470870
Entry Term(s): conophysin-R, C radiatus
Registry Number: 0
Heading Mapped to: *Mollusk Venoms
Frequency: 1
Note: the distinctive disulfide framework and sequence indicates that it is a member of the neurophysin peptide family; MW 8810.89 Da; sequence of the peptide is HPTKPCMYCSFGQCVGPHICCGPTGCEMGTAEANMCSEEDEDPIPCQVFGSDCALNNPDNIHGHCVADGICCVDDTCTTHLGCL, in first source
Source: Toxicon 2002 Jul;40(7):901-8
Date of Entry: 2003/02/06
Revision Date: 2003/02/06

conophysin-R, Conus radiatus MeSH Supplementary Concept Data 2024