MeSH Browser

MeSH Supplementary: bombinakinin M gene associated peptide, Bombina maxima
Unique ID: C480300
RDF Unique Identifier: http://id.nlm.nih.gov/mesh/C480300
Entry Term(s): bombinakinin-GAP, B. maxima
Registry Number: 0
Heading Mapped to: *Kinins
Frequency: 1
Note: a bioactive 28-amino acid peptide from skin secretions of the toad Bombina maxima; amino acid sequence is DMYEIKQYKTAHGRPPICAPGEQCPIWV-NH(2)
Source: Peptides 2003 Feb;24(2);199-204
Date of Entry: 2004/01/09
Revision Date: 2004/01/09

bombinakinin M gene associated peptide, Bombina maxima MeSH Supplementary Concept Data 2024