MeSH Browser

MeSH Supplementary: dual altered peptide ligand
Unique ID: C514281
RDF Unique Identifier: http://id.nlm.nih.gov/mesh/C514281
Entry Term(s): dual APL
Registry Number: 0
Heading Mapped to: *Peptides
Frequency: 3
Note: artificial peptide with two immunodominant T-cell epitopes of the nicotinic acetylcholine receptor substituted with Lys-262 and Ala-207 (VIVKLIPSTSSAVDTPYLDITYHFVAQRLPL)
Source: J Neuroimmunol 2006 Aug;177(1-2):63-75
Date of Entry: 2006/10/23

dual altered peptide ligand MeSH Supplementary Concept Data 2024